PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_95A52A87F.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 278aa    MW: 31683.1 Da    PI: 5.6157
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_95A52A87F.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-184188148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT eEd+ lv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Traes_5BS_95A52A87F.2 41 RGPWTVEEDLTLVNYIADHGDGRWNSLARAAGLKRTGKSCRLRWLNYL 88
                           89********************************************97 PP

2Myb_DNA-binding55.81.1e-1794137146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Traes_5BS_95A52A87F.2  94 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 137
                            89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4243688IPR017930Myb domain
SuperFamilySSF466891.69E-3039135IPR009057Homeodomain-like
SMARTSM007177.0E-154090IPR001005SANT/Myb domain
PfamPF002492.7E-164188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-234295IPR009057Homeodomain-like
CDDcd001671.11E-104388No hitNo description
PROSITE profilePS5129423.8689143IPR017930Myb domain
SMARTSM007171.2E-1593141IPR001005SANT/Myb domain
PfamPF002493.9E-1694137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2496142IPR009057Homeodomain-like
CDDcd001673.87E-1196137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MASWSSSSTQ RSSGTTMPCS VVKLDDDLLR HEEEAAEEIR RGPWTVEEDL TLVNYIADHG  60
DGRWNSLARA AGLKRTGKSC RLRWLNYLRP DVKRGNFTAD EQLLILDLHS RWGNRWSKIA  120
QHLPGRTDNE IKNYWRTRVQ KHAKQLNCDA NSSKFKDAMK YLWMPRLADH HLQQASTVGD  180
HLVPGLPTSY MESSGMVTSS SDSFASESYD GARCTNASVG EMIQGGDWVQ EQNQGFWPES  240
NQTFQLQDSE LSGWVQGFSE SESLAENFWS LEDIWKMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-263814124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3605510.0AK360551.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1120I18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579302.11e-121PREDICTED: transcription factor MYB108-like isoform X1
SwissprotQ9LDE14e-72MY108_ARATH; Transcription factor MYB108
TrEMBLW5FN370.0W5FN37_WHEAT; Uncharacterized protein
STRINGMLOC_6821.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.18e-77myb domain protein 112
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]